Sverige Apotek: Naturliga Hälsoprodukter: Superfoods, Greener, Spirulina, Alger

Earthrise, Spirulina Natural, 600 mg, 150 Capsules

Earthrise, Spirulina Natural, 600 mg, 150 Capsules Review

kr110.00

Visa i webbshop >>

Produktnamn: Earthrise, Spirulina Natural, 600 mg, 150 Capsules
Produkt Antal: 150 Count, 0.36 kg, 13.7 x 7.4 x 7.4 cm
Produktkategori: Spirulina, Alger, Superfoods, Greener, Sverige

Relaterad produkt:
Green Foods, Organic & Raw, Wheatgrass Shots, 10.6 oz (300 g)

Grön Superfood för livslängd, Kalifornien Vuxen, Kosttillskott, Earthrise Spirulina Natural, Feel the Energy of Nature’s Green Superfood! Antioxidantskydd, Kardiovaskulär hälsa, Ögon- och hjärnhälsa, Immunförsvar, Anti-aging-fördelar, Cellhälsa, Ät dina Spirulina-greener för god hälsa! En portion Earthrise Spirulina Natural motsvarar 3-4 portioner vanliga frukter och grönsaker när det gäller antioxidantinnehåll (betakaroten).

Spirulina, Alger, Superfoods, Greener: Earthrise, Spirulina Natural, 600 mg, 150 Capsules

Vår filosofi är inriktad på den starka tron ​​att högkvalitativ näring och naturliga kosttillskott är grunden för att uppnå dina hälso- och fitnessmål i den moderna världen. Förutom att det är löjligt näringsrikt är spirulina också en kraftfull antiinflammatorisk och antioxidant. Idag gissar experter att spirulina var en häftklammer i kosten för tidiga azteker. Har godkänt användningen av spirulina för undernärda barn och hiv/hjälper patienter av ett antal skäl. Eftersom vi fortfarande inte är klar med att upprätta spirulinas potentiella hälsofördelar. Flera blodmarkörer associerade med hjärtsjukdomar kan förbättra sig dramatiskt med tillskott av spirulina. När det gällde själva spirulina, använde vi något olika kriterier för att utvärdera pulver kontra kapselbaserade spirulina tillskott. En annan fördel med spirulina är dess svampdödande egenskaper. Läs mer om de mest populära grönsakerna i pulverform.

Det finns också några bevis på att spirulina kan vara effektiv hos människor. Även om det är viktigt att hålla förväntningarna i schack, kan gröna pulver ge vissa fördelar i dessa avdelningar, säger vandana sheth, en los-angeles baserad registrerad dietist och talesman för akademin för näringslära och dietetik. Poängen: Även om spirulina inte är det bästa tillskottet med alla möjliga åtgärder (vilket skulle vara svårt att bevisa definitivt, i alla fall), är det ofta utropat som det bästa alternativet för att föra näring till människor i nöd, från tredje världsländer till yttre rymden, vilket säger mycket. När de formulerade makrogröna supermatdryck tog beslutsfattarna mycket försiktighet för att se till att inga vanliga allergener ingick i blandningen. Gör att gå ner i vikt lite enklare, med inget annat än ett strö av spirulina! Registrera dig för vårt hälsotips för dagens nyhetsbrev och få dagliga tips som hjälper dig att leva ditt hälsosammaste liv. Enligt ekonomen urs heierli, phd, kan bara 1 gram spirulina per dag korrigera undernäring hos ett litet barn inom några veckor.

Relaterad produkt:
BPI Sports, Best Glutamine, Berry Citrus, 14.1 oz (400 g)

Spirulina, Alger, Superfoods, Greener: Earthrise, Spirulina Natural, 600 mg, 150 Capsules

De är lätt tillgängliga i olika produkter på marknaden nu, som proteinpulver, energistänger, gröna pulver och mer. Granskarna gillar detta spirulina-tillägg – recensionerna är överväldigande positiva, och de flesta konstaterar att de känner skillnad i energi och mättnad. Efter kärnkatastrofen i fukushima kan spirulina som odlas i området innehålla höga strålningsnivåer och bör testas/tydligt märkas före konsumtion. Människor som har det genetiska tillståndet fenylketonuri bör också undvika spirulina, eftersom det kan förvärra deras tillstånd, enligt nih. Människor anser spirulina som en supermat på grund av dess utmärkta näringsinnehåll och hälsofördelar. Icke desto mindre skulle en person behöva ta spirulina-tillskott hela dagen för att komma nära de rekommenderade dagliga mängderna av de näringsämnen som den innehåller, sade ljungmangieri, en taleskvinna för akademin för näringslära och dietetik och ägare av näringskontroll i pittsburgh, pa. Nu finns det mer ovanliga sätt att äta dina friska grönsaker, som spirulina, moringa, chlorella, matcha och vetegräs, av vilka många finns i pulverform. Hjärtsjukdomar, tillsammans med andra vanliga kroniska hälsotillstånd som diabetes typ två, är kopplade till inflammation och oxidativ skada. Uthållighetsfördelarna och förmågan att lindra allergisymtom har förmodligen mer att göra med specifika biologiskt aktiva föreningar som finns i själva spirulina, eftersom dessa är mer distinkta och unika egenskaper.

Denna kombination av spirulina och klorella kan hjälpa till att upprätthålla ett hälsosamt immunsystem och främja allmän hälsa och välbefinnande. Idrottare kan finna att ta spirulina förbättrar prestanda genom att minska oxidativ skada i muskelvävnad. Detta lovar bättre renhetskontroll än kosttillskott som kommer från någon annanstans, och näringsinnehållet i denna spirulina är utmärkt. En bekväm och lättanvänd produkt för att uppfylla kraven på alla greener under dagen. Naturbunden spirulina är ett annat ganska grundläggande spirulina-tillskott som ger en lägre dosering (ett halvt gram per tablett) och använder högtrycksbearbetning för att pressa pulvret i en tablett. En portion av den gröna supermaten har cirka fem frukt- och grönsaks portioner. Du kan rör om en liten sked spirulinapulver i ett glas vatten eller juice och dricka det rakt, eller så kan du lägga till en smoothie.

Gröna supermat kan blandas med vatten, juice eller till en smoothie.En annan fördel med att komplettera din dagliga kost med grön supermat är att det drastiskt bromsar den naturliga åldringsprocessen. Läkare anser spirulina vara säker i allmänhet, särskilt mot bakgrund av den långa historien som en mat. Några teskedar spirulina i din måltid är ett bra sätt att smyga in lite extra protein – liksom massor av vitaminer och mineraler – utan mycket kalorier eller volym. Du bör också vara särskilt uppmärksam på var japansk spirulina odlas. Dela på pinterest-studier tyder på att spirulina-tillskott kan minska det totala kolesterolet. Därför är spirulinas källa och renhet avgörande. Så här är de tio bästa gröna supermatarna jagade av thekeenhunter.

Relaterad produkt:
MRM, Raw Organic Sacha Inchi Powder, 8.5 oz (240 g)

Earthrise Spirulina – Spirulina, Alger, Superfoods, Greener

Earthrise Spirulina: Spirulina är också en av få växtkällor för vitamin B12, vilket är viktigt för friska nerver och vävnader. Superalger koncentreras till en liten, lätt att svälja kapsel. Konsumtion av gröna livsmedel (grönkål, collardgrönsaker, spirulina och bok choy, bland så många andra) är förknippade med en minskad risk för cancer, hjärtsjukdomar och typ II-diabetes tack vare deras höga nivåer av antioxidanter, vitaminer, mineraler, och fiber. Detta pulverbaserade spirulina- och klorella-tillägg är certifierat organiskt och ger en 50/50 blandning av vardera, efter vikt. Gratis och total aminosyrasammansättning i blågröna alger. Tack vare dess pulverformat och täta koncentration av näringsämnen är spirulina en av de vanligaste ingredienserna i högkvalitativa gröna supermatdrycker. Människor kan också rekommendera spirulina som ett hjälpmedel för olika psykiska och emotionella störningar, inklusive ångest, stress, depression och uppmärksamhetshinder-hyperaktivitetsstörning (Adhd). Vad vattnet innehåller kommer att sippra in i spirulina.

Dessutom kan du läsa det bästa avsnittet om gröna superfoodmatpulver ovan för att veta mer om effekterna av produkter innan du köper en. Funktionella ingredienser från mikroalger. Kom ihåg att pausen varnade jag dig för att du kan behöva ta mitt i listan över spirulinas fördelar? Cyanobakterierna främjar tillväxten av frisk bakterieflora i tarmen, vilket i slutet hindrar candida från att växa. Marknaden har nästan tusentals gröna supermat, och var och en av dem varierar drastiskt. Forskare måste utföra fler kliniska prövningar innan de vet den verkliga rollen som spirulina spelar för att stödja mental hälsa. Vad sägs om smaken av gröna supermattillskott? Intressant nog verkar antioxidanter i spirulina vara särskilt effektiva för att minska lipidperoxidation hos både människor och djur (16, 17). Väv mot hälsosamt åldrande, din online guide till den antiinflammatoriska kosten. Men vetenskaplig forskning säger också att inte alla spirulina har samma fördelar. vissa spirulina källor är bättre än andra.

Med varje köpt spirulina planterar företaget ett träd. Även om gröna pulver är koncentrerade versioner av frukt och grönsaker, bör de inte betraktas som en ersättning för riktiga, hela livsmedel (Läs: Ät din sallad)! En liten studie visade att man äter en liten mängd spirulina varje dag (2 gram), förbättrar blodtrycket och endotelfunktionen hos överviktiga patienter. En annan sak som gör spirulina till ett fantastiskt alternativ för länder och samhällen som kämpar med utbredd undernäring är att det har förmågan att hjälpa inte bara deras fysiska hälsa utan också att hjälpa dem att uppnå ekonomisk frihet. Talso, huvudmotivet är att hjälpa till att stödja din matsmältning och tarms hälsa. Medan mer forskning behövs för att se om människor också kan förbättra deras leverhälsa genom att ta spirulina, visar dessa resultat ett löfte. Detta är också ett må bra alternativ för veganer – certifieringsorganet som styr denna spirulina kräver 100% vegan och hållbart jordbruk. Observera dock att inte alla dessa ingredienser ingår i varje tillägg.

De som läkemedel eller de som kan amma eller är gravida bör diskutera att integrera gröna pulver i sin kost med en medicinsk specialist. Det betyder att spirulina är nästan 60 viktprocent. Det hjälper också att hjälpa immunsystemet med paleo- och ketovänliga dietfördelar. Forskare gav hälften barnen vitamin- och mineraltillskott och halva spirulina-tillskott i tre månader. Men som många människor kan du vara lite förvirrad över vad dessa grönalger faktiskt gör för din hälsa och vad som gör dem annorlunda. Om det är ekologisk grön näring som du letar efter ger fantastiska gräsgrön supermat. Exponering för ljus, värme och syre försämrar spirulina snabbare, så att du kan bevara kvaliteten på ditt spirulina-tillägg genom att förvara det i kylen i en lufttät och ogenomskinlig behållare, där det kommer att bevara dess antioxidantegenskaper längre. Vetegräs är en grön supermat som du kanske är lite mer bekant med.Detta kraftfulla blågrönalgtillskott innehåller organiskt spirulina-pulver och organiskt knäckt cellväggsklorellapulver.

Teorin är att spirulina är en källa till tryptofan. Dangeard studerade proverna och fann att det var en torkad puré av vårformen av de blågröna algerna från sjön. Näringsvärdet för dehydratiserade, blågröna alger (Spirulina plantensis) för fjäderfä. Många främjar spirulina som en behandling för en mängd ämnesomsättning och hjärthälsofrågor, inklusive viktminskning, diabetes och högt kolesterol, enligt de nationella institutena för hälsa (Nih). Dessutom stöder den sund matsmältning, immunsystemet med friska blodsockernivåer, och är helt vegan, certifierat, mejerifria, utan konserveringsmedel, inga tillsatta ingredienser och inga konstgjorda färger ingår.